PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0328
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 321aa    MW: 35977.6 Da    PI: 6.6967
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0328genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63.1e-14250292547
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                  +r++r++kNRe+A rsR+RK+a++ +Le +v++L++ N+ Lk 
  Gh_A06G0328 250 RRQKRMIKNRESAARSRARKQAYTNQLELEVDQLKKMNSWLKR 292
                  69************************************98884 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-10246305IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117248293IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.2E-13250294No hitNo description
SuperFamilySSF579594.5E-10250295No hitNo description
PfamPF001702.8E-12250292IPR004827Basic-leucine zipper domain
CDDcd147072.97E-25250295No hitNo description
PROSITE patternPS000360253268IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGDRFMMSPN RSEGQHFPPL ASQISSLYNL TFDEVQSQLG KIGKPLNAMN LDELLRSLIA  60
VEEGGLVQNP SSSSSSSSSA ASFFLGNINF NGTLSKKTVD EVWKEIVNNG GGNVNAMDNR  120
FVQHQLTLGE TTLEDFLVRA GVINGGIQDG VIHPQQFMAI DPMPVVSQQA DWLQFQMAAV  180
QQQQQMTMMD SNFNVPESVY ENQVVDVGYH ENQLAITMPM PAMSATSSDS QPTAARKHRY  240
SDVMEKTIER RQKRMIKNRE SAARSRARKQ AYTNQLELEV DQLKKMNSWL KRQKEVEMVL  300
SANTNDTVPK YQLRRTSSAS F
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448434.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLA0A0B0N0S30.0A0A0B0N0S3_G
STRINGPOPTR_0002s09140.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17216911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.14e-52ABA-responsive element binding protein 3